제품 > 항체 > 다중클론항체(pAb)

CYBRD1 Rabbit pAb (A17215)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using CYBRD1 Rabbit pAb (A17215) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	CYBRD1 Rabbit pAb
Catalog No.	A17215
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a member of the cytochrome b(561) family that encodes an iron-regulated protein. It highly expressed in the duodenal brush border membrane. It has ferric reductase activity and is believed to play a physiological role in dietary iron absorption.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 215-286 of human CYBRD1 (NP_079119.3).
Sequence	IFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM
Gene ID
Swiss Prot
Synonyms	DCYTB; FRRS3; CYB561A2; CYBRD1
Calculated MW	32kDa
Observed MW	36kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HT-29, A-431
Cellular location	apical plasma membrane, extracellular exosome, plasma membrane