CYP4F11 Rabbit pAb (A20682)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - CYP4F11 Rabbit pAb (A20682)

Immunofluorescence analysis of A-549 cells using CYP4F11 Rabbit pAb (A20682) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	CYP4F11 Rabbit pAb
Catalog No.	A20682
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

This gene, CYP4F11, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F2, is approximately 16 kb away. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 60-130 of human CYP4F11 (NP_001122404.1).
Sequence	FWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKP
Gene ID
Swiss Prot
Synonyms	CYPIVF11
Calculated MW	60kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location