제품 > 항체 > 다중클론항체(pAb)

CYR61 Rabbit pAb (A1111)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using CYR61 antibody (A1111) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - CYR61 Rabbit pAb (A1111)

Immunofluorescence analysis of A431 cells using CYR61 Rabbit pAb (A1111) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	CYR61 Rabbit pAb
Catalog No.	A1111
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The secreted protein encoded by this gene is growth factor-inducible and promotes the adhesion of endothelial cells. The encoded protein interacts with several integrins and with heparan sulfate proteoglycan. This protein also plays a role in cell proliferation, differentiation, angiogenesis, apoptosis, and extracellular matrix formation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 120-220 of human CYR61 (NP_001545.2).
Sequence	QCTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCDEDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRIL
Gene ID
Swiss Prot
Synonyms	GIG1; CYR61; IGFBP10
Calculated MW	42kDa
Observed MW	41kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, Mouse heart, Rat lung
Cellular location	Secreted
Customer validation	IHC(Mus musculus) WB(Homo sapiens, Mus musculus) IHC(Mus musculus) PCR(Mus musculus)