Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CYTH1 Rabbit pAb |
---|---|
Catalog No. | A15351 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human CYTH1 (NP_004753.1). |
---|---|
Sequence | MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGR |
Gene ID | |
Swiss Prot | |
Synonyms | B2-1; SEC7; PSCD1; D17S811E; CYTOHESIN-1; CYTH1 |
Calculated MW | 46kDa |
Observed MW | 46kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Raji, Mouse brain, Mouse heart, Mouse spleen, Rat heart |
Cellular location | Cell membrane, Cytoplasm, Peripheral membrane protein, cytosol |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.