제품 > 항체 > 단일클론항체(mAb)

Calcineurin A Rabbit mAb (A4346)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Calcineurin A Rabbit mAb (A4346) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	Calcineurin A Rabbit mAb
Catalog No.	A4346
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0970

Background

Enables several functions, including ATPase binding activity; calmodulin binding activity; and calmodulin-dependent protein phosphatase activity. Involved in several processes, including calcineurin-NFAT signaling cascade; peptidyl-serine dephosphorylation; and response to calcium ion. Located in several cellular components, including cytosol; dendritic spine; and nucleoplasm. Part of calcineurin complex. Colocalizes with cytoplasmic side of plasma membrane. Implicated in developmental and epileptic encephalopathy 91. Biomarker of focal segmental glomerulosclerosis and schizophrenia.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 422-521 of human Calcineurin A (Q08209).
Sequence	TLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
Gene ID
Swiss Prot
Synonyms	CALN; CCN1; CNA1; CALNA; DEE91; IECEE; PPP2B; ACCIID; CALNA1; IECEE1; Calcineurin A
Calculated MW	59kDa
Observed MW	59kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	MCF7, U-937, C6, SH-SY5Y, Mouse brain, Rat brain
Cellular location	Cell membrane, Nucleus, sarcolemma.
Customer validation	WB(Mus musculus)