제품 > 항체 > 단일클론항체(mAb)

Calpain 1 Rabbit mAb (A8710)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Calpain 1 Rabbit mAb (A8710) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunofluorescence - Calpain 1 Rabbit mAb (A8710)

Immunofluorescence analysis of C6 cells using Calpain 1 Rabbit mAb (A8710) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using Calpain 1 Rabbit mAb (A8710) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Calpain 1 Rabbit mAb
Catalog No.	A8710
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1272

Background

The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Calpain 1 (P07384).
Sequence	DGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNG
Gene ID
Swiss Prot
Synonyms	CANP; muCL; CANP1; SPG76; CANPL1; muCANP
Calculated MW	82kDa
Observed MW	75kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 -1:1000 IF/ICC 1:50 -1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	U-937, Mouse kidney
Cellular location	Cell membrane, Cytoplasm
Customer validation	WB(Rattus norvegicus, Mus musculus)