제품 > 항체 > 다중클론항체(pAb)

Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A13682)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A13682) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunohistochemistry - Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A13682)

Immunohistochemistry analysis of paraffin-embedded human stomach using Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A13682) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human gastric cancer using Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A13682) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A13682)

Immunofluorescence analysis of HeLa cells using Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb (A13682) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb
Catalog No.	A13682
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IX is a transmembrane protein and is one of only two tumor-associated carbonic anhydrase isoenzymes known. It is expressed in all clear-cell renal cell carcinoma, but is not detected in normal kidney or most other normal tissues. It may be involved in cell proliferation and transformation. This gene was mapped to 17q21.2 by fluorescence in situ hybridization, however, radiation hybrid mapping localized it to 9p13-p12.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 52-151 of human Carbonic Anhydrase 9 (CA9/G250) (NP_001207.2).
Sequence	GSSGEDDPLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWPR
Gene ID
Swiss Prot
Synonyms	MN; CAIX; Carbonic Anhydrase 9 (CA9/G250)
Calculated MW	50kDa
Observed MW	58kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse small intestine, Rat small intestine
Cellular location	Cell membrane, Cell projection, Nucleus, Single-pass type I membrane protein, microvillus membrane, nucleolus
Customer validation	WB(Homo sapiens) IF(Homo sapiens) IHC(Homo sapiens)