Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Carbonic Anhydrase 9 (CA9/G250) Rabbit pAb |
---|---|
Catalog No. | A13682 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 52-151 of human Carbonic Anhydrase 9 (CA9/G250) (NP_001207.2). |
---|---|
Sequence | GSSGEDDPLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWPR |
Gene ID | |
Swiss Prot | |
Synonyms | MN; CAIX; Carbonic Anhydrase 9 (CA9/G250) |
Calculated MW | 50kDa |
Observed MW | 58kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse small intestine, Rat small intestine |
Cellular location | Cell membrane, Cell projection, Nucleus, Single-pass type I membrane protein, microvillus membrane, nucleolus |
Customer validation | WB(Homo sapiens) IF(Homo sapiens) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A13682? Please let us know so that we can cite the reference in this datasheet.