제품 > 항체 > 단일클론항체(mAb)

Caspase-6 Rabbit mAb (A19552)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of extracts of various cell lines, using Caspase-6 antibody (A19552) at 1:1000 dilution.Jurkat cells were treated by Staurosporine(1uM) at room temperature for 3 hours .
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - Caspase-6 Rabbit mAb (A19552)

Immunofluorescence analysis of C6 cells using Caspase-6 antibody (A19552). Blue: DAPI for nuclear staining.

Overview

Product name	Caspase-6 Rabbit mAb
Catalog No.	A19552
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0031

Background

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 45-162 of human Caspase-6 (P55212).
Sequence	GIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQA
Gene ID
Swiss Prot
Synonyms	MCH2; CSP-6; caspase-6
Calculated MW	33kDa
Observed MW	33kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Jurkat, A-549, MCF7
Cellular location	Cytoplasm
Customer validation	WB(Cynoglossus semilaevis, Homo sapiens, Other, Mus musculus)