제품 > 항체 > 단일클론항체(mAb)

Caspase-6 Rabbit mAb (A22437)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Caspase-6 Rabbit mAb (A22437)at 1:1000 dilution incubated overnight at 4℃. Jurkat cells were treated by Etoposide (25 uM) at 37℃ for 5 hours. NIH/3T3 cells were treated by staurosporine (0.5 uM) for 2 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Caspase-6 Rabbit mAb (A22437)

Immunohistochemistry analysis of paraffin-embedded Mouse lung using Caspase-6 Rabbit mAb (A22437) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain using Caspase-6 Rabbit mAb (A22437) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	Caspase-6 Rabbit mAb
Catalog No.	A22437
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2627

Background

This gene encodes a member of the cysteine-aspartic acid protease (caspase) family of enzymes. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic acid residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein is processed by caspases 7, 8 and 10, and is thought to function as a downstream enzyme in the caspase activation cascade. Alternative splicing of this gene results in multiple transcript variants that encode different isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Caspase-6 (P55212).
Sequence	SLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLT
Gene ID
Swiss Prot
Synonyms	MCH2; CSP-6; caspase-6; Caspase-6
Calculated MW	33kDa
Observed MW	11kDa, 35kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Jurkat, NIH/3T3
Cellular location	Cytoplasm.