제품 > 항체 > 다중클론항체(pAb)

γ-Catenin Rabbit pAb (A0963)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using γ-Catenin Rabbit pAb (A0963) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).

ABclonal:Immunoprecipitation - γ-Catenin Rabbit pAb (A0963)

Immunoprecipitation analysis of 200 μg extracts of MCF-7 cells, using 3 μg γ-Catenin antibody (A0963). Western blot was performed from the immunoprecipitate using γ-Catenin antibody (A0963) at a dilution of 1:1000.

Overview

Product name	γ-Catenin Rabbit pAb
Catalog No.	A0963
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a major cytoplasmic protein which is the only known constituent common to submembranous plaques of both desmosomes and intermediate junctions. This protein forms distinct complexes with cadherins and desmosomal cadherins and is a member of the catenin family since it contains a distinct repeating amino acid motif called the armadillo repeat. Mutation in this gene has been associated with Naxos disease. Alternative splicing occurs in this gene; however, not all transcripts have been fully described.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human γ-Catenin (NP_002221.1).
Sequence	MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
Gene ID
Swiss Prot
Synonyms	PG; DP3; PDGB; PKGB; CTNNG; DPIII; γ-Catenin
Calculated MW	82kDa
Observed MW	82kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	MCF7, 293T, Mouse lung
Cellular location	Cell junction, Cytoplasm, Membrane, Peripheral membrane protein, adherens junction, cytoskeleton, desmosome
Customer validation	WB(Homo sapiens)