제품 > 항체 > 단일클론항체(mAb)

δ-Catenin/p120 Catenin Rabbit mAb (A11399)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using δ-Catenin/p120 Catenin Rabbit mAb (A11399) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - δ-Catenin/p120 Catenin Rabbit mAb (A11399)

Immunohistochemistry analysis of paraffin-embedded Human breast using δ-Catenin/p120 Catenin Rabbit mAb (A11399) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta using δ-Catenin/p120 Catenin Rabbit mAb (A11399) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunoprecipitation - δ-Catenin/p120 Catenin Rabbit mAb (A11399)

Immunoprecipitation analysis of 600 μg extracts of Mouse testis cells using 3 μg δ-Catenin/p120 Catenin antibody (A11399). Western blot was performed from the immunoprecipitate using δ-Catenin/p120 Catenin antibody (A11399) at a dilution of 1:1000.

Overview

Product name	δ-Catenin/p120 Catenin Rabbit mAb
Catalog No.	A11399
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0586

Background

This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 869-968 of human δ-Catenin/p120 Catenin (O60716).
Sequence	TLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI
Gene ID
Swiss Prot
Synonyms	CAS; p120; BCDS2; CTNND; P120CAS; P120CTN; p120(CAS); p120(CTN); δ-Catenin/p120 Catenin
Calculated MW	108kDa
Observed MW	100kDa/110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa cells, U-87MG cells, Mouse testis, Rat brain
Cellular location	Cell membrane, Cytoplasm.