Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Caveolin-1 Rabbit mAb (A22417) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Western blot analysis of lysates from HeLa cells, using Caveolin-1 Rabbit mAb (A22417) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Caveolin-1 Rabbit mAb (A22417) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon using Caveolin-1 Rabbit mAb (A22417) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human lung squamous carcinoma tissue using Caveolin-1 Rabbit mAb (A22417) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human lung using Caveolin-1 Rabbit mAb (A22417) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human placenta using Caveolin-1 Rabbit mAb (A22417) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human prostate cancer using Caveolin-1 Rabbit mAb (A22417) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of HeLa cells using Caveolin-1 Rabbit mAb (A22417, dilution 1:100) (Red). The cells were counterstained with Vimentin Rabbit mAb (A19607, dilution 1:100) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
| Product name | Caveolin-1 Rabbit mAb |
|---|---|
| Catalog No. | A22417 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC50840 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Caveolin-1 (NP_001744.2). |
|---|---|
| Sequence | MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CGL3; PPH3; BSCL3; LCCNS; VIP21; MSTP085; Caveolin-1 |
| Calculated MW | 20kDa |
| Observed MW | 20-25kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | HeLa, A549, Mouse lung, Mouse heart, Rat lung, Rat heart |
| Cellular location | Cell membrane, Golgi apparatus membrane, Membrane, Membrane raft, Peripheral membrane protein, Caveola |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
