Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Caveolin-1 Rabbit mAb |
---|---|
Catalog No. | A19006 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC50848 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Caveolin-1 (NP_001744.2). |
---|---|
Sequence | MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHS |
Gene ID | |
Swiss Prot | |
Synonyms | CGL3; PPH3; BSCL3; LCCNS; VIP21; MSTP085; Caveolin-1 |
Calculated MW | 17kDa/20kDa |
Observed MW | 21kDa/24kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa cells, Mouse lung , Rat lung |
Cellular location | Cell membrane, Golgi apparatus membrane, Membrane, Membrane raft, Peripheral membrane protein, caveola. |
Customer validation | WB(Mus musculus, Homo sapiens, Mus musculus, Sus scrofa, Rattus norvegicus) IF(Rattus norvegicus) IF(Sus scrofa, Rattus norvegicus) IP(Rattus norvegicus) IHC(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19006? Please let us know so that we can cite the reference in this datasheet.