Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | CXCL10/IP-10 Rabbit pAb |
---|---|
Catalog No. | A1457 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-98 of human CXCL10/IP-10 (NP_001556.2). |
---|---|
Sequence | QGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Gene ID | |
Swiss Prot | |
Synonyms | C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10; CXCL10/IP-10 |
Calculated MW | 11kDa |
Observed MW | 11kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, THP-1+IFN-γ+LPS+BFA |
Cellular location | Secreted. |
Customer validation | WB(Mus musculus, Homo sapiens) IF(Homo sapiens, Rattus norvegicus) WB(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1457? Please let us know so that we can cite the reference in this datasheet.