Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Western blot analysis of various lysates, using CXCL10/IP-10 Rabbit mAb (A21986) at 1:20000 dilution. THP-1 cells were treated by LPS for 6 hours, Brefeldin A for 3 hours and IFNγ (50ng/ml) for 8 hours of stimulation.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
| Product name | CXCL10/IP-10 Rabbit mAb |
|---|---|
| Catalog No. | A21986 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC5116-05 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human CXCL10/IP-10 (NP_001556.2) |
|---|---|
| Sequence | MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10; CXCL10/IP-10 |
| Calculated MW | 11kDa |
| Observed MW | 11kDa |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | THP-1 treated by LPS, Brefeldin A and IFNγ |
| Cellular location | Secreted. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
