제품 > 항체 > 단일클론항체(mAb)

Caveolin-2 Rabbit mAb (A4890)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from Mouse lung, using Caveolin-2 Rabbit mAb (A4890) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from 293T cells, using Caveolin-2 Rabbit mAb (A4890) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Caveolin-2 Rabbit mAb (A4890)

Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Caveolin-2 Rabbit mAb (A4890) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - Caveolin-2 Rabbit mAb (A4890)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg Caveolin-2 antibody (A4890). Western blot was performed from the immunoprecipitate using Caveolin-2 antibody (A4890) at a dilution of 1:1000.

Overview

Product name	Caveolin-2 Rabbit mAb
Catalog No.	A4890
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0323

Background

The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. This gene and related family member (CAV1) are located next to each other on chromosome 7, and express colocalizing proteins that form a stable hetero-oligomeric complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Additional isoforms resulting from the use of alternate in-frame translation initiation codons have also been described, and shown to have preferential localization in the cell (PMID:11238462).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Caveolin-2 (P51636).
Sequence	MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIA
Gene ID
Swiss Prot
Synonyms	CAV; Caveolin-2
Calculated MW	18kDa
Observed MW	21kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, 293T, Mouse lung
Cellular location	Cell membrane, Cytoplasm, Golgi apparatus membrane, Membrane, Nucleus, Peripheral membrane protein, Caveola
Customer validation	IF(Other)