제품 > 항체 > 다중클론항체(pAb)

Ch25h Rabbit pAb (A13832)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using Ch25h antibody (A13832) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Overview

Product name	Ch25h Rabbit pAb
Catalog No.	A13832
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables cholesterol 25-hydroxylase activity. Involved in B cell chemotaxis. Acts upstream of or within cholesterol metabolic process. Predicted to be located in endoplasmic reticulum. Predicted to be integral component of membrane. Predicted to be active in endoplasmic reticulum membrane. Is expressed in several structures, including genitourinary system; gut; hemolymphoid system gland; respiratory system; and skin. Orthologous to human CH25H (cholesterol 25-hydroxylase).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of mouse Ch25h (NP_034020.1).
Sequence	IFTFHVINIWLSVEDHSGYDFPWSTHRLVPFGWYGGVAHHDMHHSQFNCNFAPYFTHWDKMLGTLRSAPLPESLCACGERCVNSRERCAVHLIQKKKQT
Gene ID
Swiss Prot
Synonyms	m25OH
Calculated MW	31kDa
Observed MW	36kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-549, Mouse heart
Cellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein
Customer validation	WB(Mesocricetus auratus, Mus musculus )