Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | Chk2 Rabbit mAb |
---|---|
Catalog No. | A19543 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC57076 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Chk2 (O96017). |
---|---|
Sequence | MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQ |
Gene ID | |
Swiss Prot | |
Synonyms | CDS1; CHK2; LFS2; RAD53; hCds1; HuCds1; PP1425; Chk2 |
Calculated MW | 15-38kDa/50-65kDa |
Observed MW | 65kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, C2C12 |
Cellular location | Nucleus, PML body, nucleoplasm. |
Customer validation | WB(Homo sapiens) IHC(Homo sapiens) RIP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19543? Please let us know so that we can cite the reference in this datasheet.