Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of various lysates, using Cip4 Rabbit mAb (A20891) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
| Product name | Cip4 Rabbit mAb |
|---|---|
| Catalog No. | A20891 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2844 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cip4 (Q15642). |
|---|---|
| Sequence | MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | STP; CIP4; HSTP; STOT; TRIP-10 |
| Calculated MW | 68kDa |
| Observed MW | 76kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | HeLa, Hep G2, Mouse skeletal muscle, Mouse heart |
| Cellular location | Cell membrane, Cell projection, Cytoplasm, Golgi apparatus, Lysosome, cell cortex, cytoskeleton, perinuclear region, phagocytic cup |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
