제품 > 항체 > 다중클론항체(pAb)

Clusterin alpha chain Rabbit pAb (A12913)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Clusterin alpha chain Rabbit pAb (A12913) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - Clusterin alpha chain Rabbit pAb (A12913)

Immunohistochemistry analysis of paraffin-embedded rat spleen using Clusterin alpha chain Rabbit pAb (A12913) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human lung using Clusterin alpha chain Rabbit pAb (A12913) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using Clusterin alpha chain Rabbit pAb (A12913) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human esophageal using Clusterin alpha chain Rabbit pAb (A12913) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	Clusterin alpha chain Rabbit pAb
Catalog No.	A12913
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 314-449 of human Clusterin alpha chain (NP_001822.3).
Sequence	STNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Gene ID
Swiss Prot
Synonyms	CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; Clusterin alpha chain
Calculated MW	52kDa
Observed MW	37-40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Human plasma, Mouse plasma, Rat plasma
Cellular location	Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Endoplasmic reticulum, Microsome, Mitochondrion membrane, Nucleus, Peripheral membrane protein, Secreted, chromaffin granule, cytosol, secretory vesicle
Customer validation	WB(Rattus norvegicus)