제품 > 항체 > 다중클론항체(pAb)

Clusterin Rabbit pAb (A13479)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Clusterin Rabbit pAb (A13479) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Clusterin Rabbit pAb (A13479)

Immunohistochemistry analysis of paraffin-embedded Human colon cancer tissue using Clusterin Rabbit pAb (A13479) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Clusterin Rabbit pAb (A13479) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Clusterin Rabbit pAb (A13479)

Immunofluorescence analysis of U2OS cells using Clusterin Rabbit pAb (A13479). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Clusterin Rabbit pAb
Catalog No.	A13479
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 220-449 of human Clusterin alpha chain (NP_976084.1).
Sequence	FPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
Gene ID
Swiss Prot
Synonyms	CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; Clusterin
Calculated MW	52kDa
Observed MW	38kDa/57kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HepG2, U-251MG, Human plasma, Mouse plasma
Cellular location	Cytoplasm, Cytoplasmic side, Cytoplasmic vesicle, Endoplasmic reticulum, Microsome, Mitochondrion membrane, Nucleus, Peripheral membrane protein, Secreted, chromaffin granule, cytosol, secretory vesicle.
Customer validation	WB(Homo sapiens, Mus musculus)