Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | Collagen I/COL1A2 Rabbit mAb |
---|---|
Catalog No. | A21059 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC52128 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen I/COL1A2 (NP_000080.2). |
---|---|
Sequence | PTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAA |
Gene ID | |
Swiss Prot | |
Synonyms | OI4; EDSCV; EDSARTH2; Collagen I/COL1A2 |
Calculated MW | 129kDa |
Observed MW | 129kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse bone, Rat skin |
Cellular location | Secreted, extracellular matrix, Extracellular space. |
Customer validation | IF(Gallus gallus, Homo sapiens, Mus musculus) WB(Oryctolagus cuniculus, Mus musculus, Homo sapiens, Rattus norvegicus) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21059? Please let us know so that we can cite the reference in this datasheet.