제품 > 항체 > 단일클론항체(mAb)

Collagen X/COL10A1 Rabbit mAb (A11645)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using Collagen X/COL10A1 Rabbit mAb (A11645) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	Collagen X/COL10A1 Rabbit mAb
Catalog No.	A11645
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0659

Background

This gene encodes the alpha chain of type X collagen, a short chain collagen expressed by hypertrophic chondrocytes during endochondral ossification. Unlike type VIII collagen, the other short chain collagen, type X collagen is a homotrimer. Mutations in this gene are associated with Schmid type metaphyseal chondrodysplasia (SMCD) and Japanese type spondylometaphyseal dysplasia (SMD).

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Collagen X/COL10A1 (Q03692).
Sequence	HSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFS
Gene ID
Swiss Prot
Synonyms	COL10A1; collagen alpha-1(X) chain; Collagen X/COL10A1
Calculated MW	66kDa
Observed MW	66kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse liver, Rat liver
Cellular location	Secreted, extracellular matrix, extracellular space.
Customer validation	WB(Gallus gallus, Mus musculus) IF(Mus musculus)