Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Collagen XVII/COL17A1 Rabbit mAb |
---|---|
Catalog No. | A4808 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0233 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human Collagen XVII/COL17A1 (Q9UMD9). |
---|---|
Sequence | SVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGP |
Gene ID | |
Swiss Prot | |
Synonyms | ERED; JEB4; BP180; BPA-2; BPAG2; LAD-1; BA16H23.2; Collagen XVII/COL17A1 |
Calculated MW | 150kDa |
Observed MW | 150-180kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | A431 |
Cellular location | Cell junction, Membrane, Secreted, Single-pass type II membrane protein, basement membrane, extracellular matrix, extracellular space, hemidesmosome |
Customer validation | WB(Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A4808? Please let us know so that we can cite the reference in this datasheet.