제품 > 항체 > 단일클론항체(mAb)

Collagen XVII/COL17A1 Rabbit mAb (A4808)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from A-431 cells, using Collagen XVII/COL17A1 Rabbit mAb (A4808) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Collagen XVII/COL17A1 Rabbit mAb (A4808)

Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using Collagen XVII/COL17A1 Rabbit mAb (A4808) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	Collagen XVII/COL17A1 Rabbit mAb
Catalog No.	A4808
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0233

Background

This gene encodes the alpha chain of type XVII collagen. Unlike most collagens, collagen XVII is a transmembrane protein. Collagen XVII is a structural component of hemidesmosomes, multiprotein complexes at the dermal-epidermal basement membrane zone that mediate adhesion of keratinocytes to the underlying membrane. Mutations in this gene are associated with both generalized atrophic benign and junctional epidermolysis bullosa. Two homotrimeric forms of type XVII collagen exist. The full length form is the transmembrane protein. A soluble form, referred to as either ectodomain or LAD-1, is generated by proteolytic processing of the full length form.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human Collagen XVII/COL17A1 (Q9UMD9).
Sequence	SVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGP
Gene ID
Swiss Prot
Synonyms	ERED; JEB4; BP180; BPA-2; BPAG2; LAD-1; BA16H23.2; Collagen XVII/COL17A1
Calculated MW	150kDa
Observed MW	150-180kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	A431
Cellular location	Cell junction, Membrane, Secreted, Single-pass type II membrane protein, basement membrane, extracellular matrix, extracellular space, hemidesmosome