제품 > 항체 > 다중클론항체(pAb)

Cortactin Rabbit pAb (A5795)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Cortactin Rabbit pAb antibody (A5795) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.5s.

Western blot analysis of extracts of Mouse kidney, using Cortactin Rabbit pAb antibody (A5795) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - Cortactin Rabbit pAb (A5795)

Immunofluorescence analysis of A-431 using Cortactin antibody (A5795) at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 using Cortactin antibody (A5795) at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa using Cortactin antibody (A5795) at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 using Cortactin antibody (A5795) at dilution of 1:25 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	Cortactin Rabbit pAb
Catalog No.	A5795
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 301-400 of human Cortactin (NP_005222.2).
Sequence	DYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQ
Gene ID
Swiss Prot
Synonyms	EMS1
Calculated MW	62kDa
Observed MW	80kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, U-937（negative control sample）, Mouse kidney
Cellular location	Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoplasmic side, Membrane, Peripheral membrane protein, cell cortex, clathrin-coated pit, cytoskeleton, dendrite, dendritic spine, focal adhesion, lamellipodium, podosome, ruffle
Customer validation	WB(Rattus norvegicus)