Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Cyclin A2 Rabbit pAb |
---|---|
Catalog No. | A7632 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 350-432 of human Cyclin A2 (NP_001228.1). |
---|---|
Sequence | YLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL |
Gene ID | |
Swiss Prot | |
Synonyms | CCN1; CCNA; Cyclin A2 |
Calculated MW | 49kDa |
Observed MW | 55kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse brain, Mouse liver, Mouse spleen, Mouse eye, Rat spinal cord |
Cellular location | Cytoplasm, Nucleus |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus, Rattus norvegicus) IP(Rattus norvegicus) IHC(Homo sapiens, Rattus norvegicus) IF(Homo sapiens, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7632? Please let us know so that we can cite the reference in this datasheet.