Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | Cyclin D1 Rabbit mAb |
---|---|
Catalog No. | A22104 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51669 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Cyclin D1 (NP_444284.1). |
---|---|
Sequence | WNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQ |
Gene ID | |
Swiss Prot | |
Synonyms | BCL1; PRAD1; U21B31; D11S287E; Cyclin D1 |
Calculated MW | 34kDa |
Observed MW | 35kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | C6, Mouse lung |
Cellular location | Cytoplasm, Membrane, Nucleus |
Customer validation | WB(Mus musculus , Homo sapiens, Mus musculus) IHC(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22104? Please let us know so that we can cite the reference in this datasheet.