Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | Cyclin H Rabbit mAb |
---|---|
Catalog No. | A21885 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2823 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cyclin H (P51946). |
---|---|
Sequence | MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYH |
Gene ID | |
Swiss Prot | |
Synonyms | CAK; p34; p37; CycH |
Calculated MW | 38kDa |
Observed MW | 35kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | NIH/3T3, Jurkat, Mouse testis |
Cellular location | Nucleus |
Customer validation | WB(Homo sapiens, Mus musculus,) IHC(Homo sapiens, Mus musculus,) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21885? Please let us know so that we can cite the reference in this datasheet.