제품 > 항체 > 단일클론항체(mAb)

Cyclophilin 40 Rabbit mAb (A5097)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Cyclophilin 40 Rabbit mAb (A5097) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Cyclophilin 40 Rabbit mAb (A5097)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Cyclophilin 40 Rabbit mAb (A5097) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	Cyclophilin 40 Rabbit mAb
Catalog No.	A5097
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1260

Background

The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 271-370 of human Cyclophilin 40 (Q08752).
Sequence	IALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA
Gene ID
Swiss Prot
Synonyms	CYPD; CYP-40; Cyclophilin 40
Calculated MW	41kDa
Observed MW	41kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	NIH/3T3, Jurkat, C6, Mouse brain, Rat brain
Cellular location	Cytoplasm, Nucleus, nucleolus, nucleoplasm
Customer validation	WB(Rattus norvegicus)