제품 > 항체 > 단일클론항체(mAb)

Cytochrome P450 4A (CYP4A11) Rabbit mAb (A19662)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Cytochrome P450 4A (CYP4A11) (CYP4A11) Rabbit mAb (A19662) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Cytochrome P450 4A (CYP4A11) Rabbit mAb (A19662)

Immunohistochemistry analysis of Cytochrome P450 4A (CYP4A11) in paraffin-embedded rat kidney tissue using Cytochrome P450 4A (CYP4A11) Rabbit mAb (A19662) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Cytochrome P450 4A (CYP4A11) in paraffin-embedded mouse kidney tissue using Cytochrome P450 4A (CYP4A11) Rabbit mAb (A19662) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Cytochrome P450 4A (CYP4A11) in paraffin-embedded human liver tissue using Cytochrome P450 4A (CYP4A11) Rabbit mAb (A19662) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	Cytochrome P450 4A (CYP4A11) Rabbit mAb
Catalog No.	A19662
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2219

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and hydroxylates medium-chain fatty acids such as laurate and myristate. Multiple transcript variants have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Cytochrome P450 4A (CYP4A11) (CYP4A11) (Q02928).
Sequence	QFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAF
Gene ID
Swiss Prot
Synonyms	CP4Y; CYP4A2; CYP4AII; CYPIVA11; Cytochrome P450 4A (CYP4A11)
Calculated MW	59kDa
Observed MW

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse liver, Rat liver, Rat kidney
Cellular location	Apical plasma membrane, Cytoplasm
Customer validation	IHC(Homo sapiens)