제품 > 항체 > 다중클론항체(pAb)

D61 Rabbit pAb (A20670)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Oryza sativa

Western blot analysis of extracts of various tissues from the japonica rice (Oryza sativa L.) variety Zhonghua 11, using D61 Rabbit pAb (A20670) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Overview

Product name	D61 Rabbit pAb
Catalog No.	A20670
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Receptor kinase involved brassinosteroid (BR) signal transduction. Regulates, in response to BR binding, a signaling cascade involved in plant development, promotion of cell elongation and flowering (Probable). Activates BR signaling by targeting and phosphorylating BSK3, a positive regulator of BR signaling

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 65-258 of Oryza sativa D61. (Q942F3).
Sequence	RLTSLSLAGVPLNAEFRAVAATLLQLGSVEVLSLRGANVSGALSAAGGARCGSKLQALDLSGNAALRGSVADVAALASACGGLKTLNLSGDAVGAAKVGGGGGPGFAGLDSLDLSNNKITDDSDLRWMVDAGVGAVRWLDLALNRISGVPEFTNCSGLQYLDLSGNLIVGEVPGGALSDCRGLKVLNLSFNHLA
Gene ID
Swiss Prot
Synonyms	D61; BRI1; OsBRI1
Calculated MW	120kDa
Observed MW	120kDa

Applications

Reactivity	Oryza sativa
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	stems, Spikes
Cellular location	plasma membrane