제품 > 항체 > 다중클론항체(pAb)

DAPK2 Rabbit pAb (A8199)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of Rat skeletal muscle, using DAPK2 antibody (A8199) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - DAPK2 Rabbit pAb (A8199)

Immunofluorescence analysis of NIH/3T3 cells using DAPK2 Rabbit pAb (A8199) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using DAPK2 Rabbit pAb (A8199) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using DAPK2 Rabbit pAb (A8199) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	DAPK2 Rabbit pAb
Catalog No.	A8199
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that belongs to the serine/threonine protein kinase family. This protein contains a N-terminal protein kinase domain followed by a conserved calmodulin-binding domain with significant similarity to that of death-associated protein kinase 1 (DAPK1), a positive regulator of programmed cell death. Overexpression of this gene was shown to induce cell apoptosis. It uses multiple polyadenylation sites.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DAPK2 (NP_055141.2).
Sequence	MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVV
Gene ID
Swiss Prot
Synonyms	DRP1; DRP-1
Calculated MW	43kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Rat skeletal muscle
Cellular location	Cytoplasm, Cytoplasmic vesicle, autophagosome lumen
Customer validation	WB(Homo sapiens)