제품 > 항체 > 다중클론항체(pAb)

DAPP1 Rabbit pAb (A13716)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using DAPP1 Rabbit pAb (A13716) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	DAPP1 Rabbit pAb
Catalog No.	A13716
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables phosphatidylinositol-3, 4, 5-trisphosphate binding activity and phosphatidylinositol-3, 4-bisphosphate binding activity. Predicted to be involved in signal transduction. Located in plasma membrane.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-273 of human DAPP1 (NP_055210.2).
Sequence	SSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIR
Gene ID
Swiss Prot
Synonyms	BAM32; DAPP1
Calculated MW	32kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Rat spleen, Rat lung
Cellular location	Cytoplasm, Membrane, Peripheral membrane protein