제품 > 항체 > 단일클론항체(mAb)

DDX17 Rabbit mAb (A5731)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using DDX17 Rabbit mAb (A5731) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - DDX17 Rabbit mAb (A5731)

Immunohistochemistry analysis of DDX17 in paraffin-embedded human cervix cancer tissue using DDX17 Rabbit mAb (A5731) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse brain tissue using DDX17 Rabbit mAb (A5731) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse intestin tissue using DDX17 Rabbit mAb (A5731) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse lung tissue using DDX17 Rabbit mAb (A5731) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse testis tissue using DDX17 Rabbit mAb (A5731) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of DDX17 in paraffin-embedded rat brain tissue using DDX17 Rabbit mAb (A5731) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of DDX17 in paraffin-embedded rat kidney tissue using DDX17 Rabbit mAb (A5731) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of DDX17 in paraffin-embedded rat spleen tissue using DDX17 Rabbit mAb (A5731) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Overview

Product name	DDX17 Rabbit mAb
Catalog No.	A5731
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1413

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an ATPase activated by a variety of RNA species, but not by dsDNA. This protein, and that encoded by DDX5 gene, are more closely related to each other than to any other member of the DEAD box family. This gene can encode multiple isoforms due to both alternative splicing and the use of alternative translation initiation codons, including a non-AUG (CUG) start codon.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human DDX17 (Q92841).
Sequence	RGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQ
Gene ID
Swiss Prot
Synonyms	P72; RH70
Calculated MW	80kDa
Observed MW	72kDa/82kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, HCT116, Mouse brain, Rat brain
Cellular location	Nucleus