제품 > 항체 > 다중클론항체(pAb)

DDX21 Rabbit pAb (A14820)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using DDX21 Rabbit pAb (A14820) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - DDX21 Rabbit pAb (A14820)

Immunohistochemistry analysis of paraffin-embedded mouse testis using DDX21 Rabbit pAb (A14820) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse brain using DDX21 Rabbit pAb (A14820) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - DDX21 Rabbit pAb (A14820)

Immunofluorescence analysis of U-2 OS cells using DDX21 Rabbit pAb (A14820) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Confocal immunofluorescence analysis of U2OS cells using DDX21 Rabbit pAb (A14820) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	DDX21 Rabbit pAb
Catalog No.	A14820
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is an antigen recognized by autoimmune antibodies from a patient with watermelon stomach disease. This protein unwinds double-stranded RNA, folds single-stranded RNA, and may play important roles in ribosomal RNA biogenesis, RNA editing, RNA transport, and general transcription.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human DDX21 (NP_004719.2).
Sequence	MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIP
Gene ID
Swiss Prot
Synonyms	RH; GUA; GURDB; II/Gu; RH II/Gu; RH-II/GU; gu-alpha; RH-II/GuA; DDX21
Calculated MW	87kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, Jurkat, Hep G2, K-562
Cellular location	Nucleus, nucleolus, nucleoplasm
Customer validation	WB(Homo sapiens, Mus musculus) ELISA(Homo sapiens, Mus musculus) IF(Mus musculus)