제품 > 항체 > 다중클론항체(pAb)

DEFB132 Rabbit pAb (A13689)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Immunohistochemistry analysis of paraffin-embedded human colon using DEFB132 Rabbit pAb (A13689) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human esophagus using DEFB132 Rabbit pAb (A13689) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using DEFB132 Rabbit pAb (A13689) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	DEFB132 Rabbit pAb
Catalog No.	A13689
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The protein encoded by this gene is secreted and is a member of the beta defensin protein family. This protein binds spermatozoa and has antimicrobial activity against E. coli. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 20p13.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human DEFB132 (NP_997352.1).
Sequence	MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
Gene ID
Swiss Prot
Synonyms	BD-32; DEFB32; HEL-75; UNQ827; DEFB-32; KFLL827; DEFB132
Calculated MW	11kDa
Observed MW	Refer to Figures

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples
Cellular location	Secreted