Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | DEGS1 Rabbit pAb |
---|---|
Catalog No. | A12648 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 234-323 of human DEGS1 (NP_003667.1). |
---|---|
Sequence | YMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE |
Gene ID | |
Swiss Prot | |
Synonyms | MLD; DEGS; DES1; Des-1; FADS7; HLD18; MIG15; DEGS-1; DEGS1 |
Calculated MW | 38kDa |
Observed MW | 38kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, A-549, 293T |
Cellular location | Endoplasmic reticulum membrane, Lipid-anchor, Membrane, Mitochondrion, Multi-pass membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.