Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | DERL1 Rabbit pAb |
---|---|
Catalog No. | A8508 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 182-251 of human DERL1 (NP_077271.1). |
---|---|
Sequence | LYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ |
Gene ID | |
Swiss Prot | |
Synonyms | DER1; DER-1; derlin-1 |
Calculated MW | 29kDa |
Observed MW | 29kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | MCF7, Mouse liver |
Cellular location | Endoplasmic reticulum membrane, Multi-pass membrane protein |
Customer validation | WB(Homo sapiens, Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A8508? Please let us know so that we can cite the reference in this datasheet.