제품 > 항체 > 단일클론항체(mAb)

DHX9/RNA Helicase A Rabbit mAb (A4563)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using DHX9/RNA Helicase A Rabbit mAb (A4563) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - DHX9/RNA Helicase A Rabbit mAb (A4563)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using DHX9/RNA Helicase A Rabbit mAb (A4563) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon using DHX9/RNA Helicase A Rabbit mAb (A4563) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human placenta using DHX9/RNA Helicase A Rabbit mAb (A4563) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using DHX9/RNA Helicase A Rabbit mAb (A4563) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver using DHX9/RNA Helicase A Rabbit mAb (A4563) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain using DHX9/RNA Helicase A Rabbit mAb (A4563) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat liver using DHX9/RNA Helicase A Rabbit mAb (A4563) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen using DHX9/RNA Helicase A Rabbit mAb (A4563) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis using DHX9/RNA Helicase A Rabbit mAb (A4563) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - DHX9/RNA Helicase A Rabbit mAb (A4563)

Confocal imaging of U-2 OS cells using DHX9/RNA Helicase A Rabbit mAb (A4563, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - DHX9/RNA Helicase A Rabbit mAb (A4563)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg DHX9/DHX9/RNA Helicase A antibody (A4563). Western blot was performed from the immunoprecipitate using DHX9/DHX9/RNA Helicase A antibody (A4563) at a dilution of 1:2000.

Overview

Product name	DHX9/RNA Helicase A Rabbit mAb
Catalog No.	A4563
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1033

Background

This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human DHX9/RNA Helicase A (Q08211).
Sequence	ITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISRPSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGGYGSGGYG
Gene ID
Swiss Prot
Synonyms	LKP; RHA; DDX9; NDH2; NDHII; DHX9/RNA Helicase A
Calculated MW	141kDa
Observed MW	141kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:2000 IF/ICC 1:100 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, Mouse testis
Cellular location	Cytoplasm, Nucleus, nucleolus.