Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | DIAPH1 Rabbit mAb |
---|---|
Catalog No. | A11596 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0639 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DIAPH1 (O60610). |
---|---|
Sequence | MEPPGGSLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFTLKRLMADELERFTSMRIKKEKEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQML |
Gene ID | |
Swiss Prot | |
Synonyms | DIA1; DRF1; DFNA1; LFHL1; SCBMS; hDIA1; mDia1 |
Calculated MW | 141kDa |
Observed MW | 180kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, Mouse lung, Rat testis |
Cellular location | Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Ruffle membrane, Nucleus |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11596? Please let us know so that we can cite the reference in this datasheet.