제품 > 항체 > 다중클론항체(pAb)

DIAPH1 Rabbit pAb (A5772)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using DIAPH1 Rabbit pAb (A5772) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - DIAPH1 Rabbit pAb (A5772)

Immunofluorescence analysis of U2OS cells using DIAPH1 Rabbit pAb (A5772). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review

Overview

Product name	DIAPH1 Rabbit pAb
Catalog No.	A5772
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a homolog of the Drosophila diaphanous gene, and has been linked to autosomal dominant, fully penetrant, nonsyndromic sensorineural progressive low-frequency hearing loss. Actin polymerization involves proteins known to interact with diaphanous protein in Drosophila and mouse. It has therefore been speculated that this gene may have a role in the regulation of actin polymerization in hair cells of the inner ear. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1149-1263 of human DIAPH1 (NP_001073280.1).
Sequence	TEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS
Gene ID
Swiss Prot
Synonyms	DIA1; DRF1; DFNA1; LFHL1; SCBMS; hDIA1; mDia1; DIAPH1
Calculated MW	141kDa
Observed MW	178kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HL-60, MCF7, 293T, HepG2, Mouse liver, Mouse lung
Cellular location	Cell membrane, Cell projection, Cytoplasm, cytoskeleton, ruffle membrane
Customer validation	(A172) WB(Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DIAPH1 Rabbit pAb images

Western blot - DIAPH1 Rabbit pAb (A5772)

Immunofluorescence - DIAPH1 Rabbit pAb (A5772)

Immunofluorescence analysis of U2OS cells using DIAPH1 Rabbit pAb (A5772). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.