제품 > 항체 > 단일클론항체(mAb)

DISC1 Rabbit mAb (A4678)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using DISC1 Rabbit mAb (A4678) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - DISC1 Rabbit mAb (A4678)

Immunofluorescence analysis of C6 cells using DISC1 Rabbit mAb (A4678) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using DISC1 Rabbit mAb (A4678) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using DISC1 Rabbit mAb (A4678) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	DISC1 Rabbit mAb
Catalog No.	A4678
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1089

Background

This gene encodes a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins. This gene is disrupted in a t(1;11)(q42.1;q14.3) translocation which segregates with schizophrenia and related psychiatric disorders in a large Scottish family. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DISC1 (Q9NRI5).
Sequence	MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGGVSGEESHHSESRARQCGLDSRGLLVRSPVS
Gene ID
Swiss Prot
Synonyms	SCZD9; C1orf136
Calculated MW	94kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, MCF7, SH-SY5Y, Mouse brain, Mouse heart, Rat brain, Rat heart
Cellular location	Cell junction, Cytoplasm, Centrosome, Cytoskeleton, Microtubule organizing center, Postsynaptic cell membrane, Postsynaptic density, synapse
Customer validation	IF(Homo sapiens, Mus musculus) IHC(Mus musculus)