Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts of various cell lines, using DLDH/DLD Rabbit mAb (A5220) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of DLDH/DLD in paraffin-embedded human colon carcinoma tissue using DLDH/DLD Rabbit mAb (A5220) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of DLDH/DLD in paraffin-embedded human esophagus tissue using DLDH/DLD Rabbit mAb (A5220) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of DLDH/DLD in paraffin-embedded human kidney tissue using DLDH/DLD Rabbit mAb (A5220) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of DLDH/DLD in paraffin-embedded human liver tissue using DLDH/DLD Rabbit mAb (A5220) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of DLDH/DLD in paraffin-embedded human tonsil tissue using DLDH/DLD Rabbit mAb (A5220) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of DLDH/DLD in paraffin-embedded mouse kidney tissue using DLDH/DLD Rabbit mAb (A5220) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of DLDH/DLD in paraffin-embedded rat spleen tissue using DLDH/DLD Rabbit mAb (A5220) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of NIH-3T3 cells using DLDH/DLD Rabbit mAb (A5220) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
| Product name | DLDH/DLD Rabbit mAb |
|---|---|
| Catalog No. | A5220 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1224 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 401-500 of human DLDH/DLD (P09622). |
|---|---|
| Sequence | WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | E3; LAD; DLDD; DLDH; GCSL; PHE3; OGDC-E3 |
| Calculated MW | 54kDa |
| Observed MW | 60kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | SKOV3, U-251MG, Mouse liver, Mouse brain, Rat brain |
| Cellular location | Mitochondrion matrix, Nucleus |
| Customer validation | WB(Mus musculus, Homo sapiens) IHC(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5220? Please let us know so that we can cite the reference in this datasheet.
