제품 > 항체 > 단일클론항체(mAb)

DNAJC15 Rabbit mAb (A4825)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using DNAJC15 Rabbit mAb (A4825) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - DNAJC15 Rabbit mAb (A4825)

Immunofluorescence analysis of NIH-3T3 cells using DNAJC15 Rabbit mAb (A4825) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	DNAJC15 Rabbit mAb
Catalog No.	A4825
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0249

Background

Predicted to enable ATPase activator activity. Predicted to be involved in protein import into mitochondrial matrix. Predicted to act upstream of or within several processes, including cellular response to starvation; negative regulation of mitochondrial electron transport, NADH to ubiquinone; and negative regulation of protein-containing complex assembly. Predicted to be located in mitochondrial inner membrane. Predicted to be part of PAM complex, Tim23 associated import motor.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 70-150 of human DNAJC15 (Q9Y5T4).
Sequence	ETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
Gene ID
Swiss Prot
Synonyms	MCJ; HSD18; DNAJD1
Calculated MW	16kDa
Observed MW	18kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, Mouse testis, Mouse brain, Mouse kidney, Rat testis, Rat brain
Cellular location	Mitochondrion inner membrane, Single-pass membrane protein