제품 > 항체 > 다중클론항체(pAb)

DNAJC4 Rabbit pAb (A23874)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Immunofluorescence analysis of HepG2 cells using DNAJC4 Rabbit pAb (A23874) at dilution of 1:20 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using DNAJC4 Rabbit pAb (A23874) at dilution of 1:20 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	DNAJC4 Rabbit pAb
Catalog No.	A23874
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be involved in response to unfolded protein. Predicted to be integral component of membrane.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 35-100 of human DNAJC4(NP_005519.2).
Sequence	YYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLR
Gene ID
Swiss Prot
Synonyms	HSPF2; MCG18; DANJC4; DNAJC4
Calculated MW	28kDa
Observed MW

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	Membrane