제품 > 항체 > 단일클론항체(mAb)

DNA topoisomerase I (TOP1) Rabbit mAb (A12409)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using DNA topoisomerase I (DNA topoisomerase I (TOP1)) Rabbit mAb (A12409) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from Mouse thymus, using DNA topoisomerase I (DNA topoisomerase I (TOP1)) Rabbit mAb (A12409) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - DNA topoisomerase I (TOP1) Rabbit mAb (A12409)

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using DNA topoisomerase I (DNA topoisomerase I (TOP1)) Rabbit mAb (A12409) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunofluorescence - DNA topoisomerase I (TOP1) Rabbit mAb (A12409)

Confocal imaging of U-2 OS cells using DNA topoisomerase I (TOP1) Rabbit mAb (A12409, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - DNA topoisomerase I (TOP1) Rabbit mAb (A12409)

Immunoprecipitation analysis of 300 μg extracts of MCF7 cells using 3 μg DNA topoisomerase I (TOP1) antibody (A12409). Western blot was performed from the immunoprecipitate using DNA topoisomerase I (TOP1) antibody (A12409) at a dilution of 1:1000.

Overview

Product name	DNA topoisomerase I (TOP1) Rabbit mAb
Catalog No.	A12409
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0708

Background

This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (TOP1) (P11387).
Sequence	MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Gene ID
Swiss Prot
Synonyms	TOPI; DNA topoisomerase I (TOP1)
Calculated MW	91kDa
Observed MW	100kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:800 IF/ICC 1:100 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	Mouse thymus, HeLa, MCF7, NIH/3T3, K-562
Cellular location	Nucleus, nucleolus, nucleoplasm.
Customer validation	WB(Homo sapiens) IF(Mus musculus)