Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | DNA topoisomerase I (TOP1) Rabbit mAb |
---|---|
Catalog No. | A12409 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0708 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (TOP1) (P11387). |
---|---|
Sequence | MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA |
Gene ID | |
Swiss Prot | |
Synonyms | TOPI; DNA topoisomerase I (TOP1) |
Calculated MW | 91kDa |
Observed MW | 100kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | Mouse thymus, HeLa, MCF7, NIH/3T3, K-562 |
Cellular location | Nucleus, nucleolus, nucleoplasm. |
Customer validation | WB(Homo sapiens, Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A12409? Please let us know so that we can cite the reference in this datasheet.