제품 > 항체 > 다중클론항체(pAb)

DPPA2 Rabbit pAb (A14966)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using DPPA2 Rabbit pAb (A14966) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	DPPA2 Rabbit pAb
Catalog No.	A14966
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to enable chromatin binding activity. Predicted to be involved in system development. Predicted to act upstream of or within several processes, including lung-associated mesenchyme development; positive regulation of stem cell proliferation; and regulation of histone methylation. Located in nucleoplasm.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DPPA2 (NP_620170.3).
Sequence	MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPK
Gene ID
Swiss Prot
Synonyms	CT100; PESCRG1; ECAT15-2; DPPA2
Calculated MW	34kDa
Observed MW	34kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SH-SY5Y, Jurkat, Mouse ovary, Mouse uterus, Rat ovary, Rat uterus
Cellular location	Nucleus