제품 > 항체 > 다중클론항체(pAb)

DRD1 Rabbit pAb (A2893)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Rat

Western blot analysis of extracts of Rat brain, using DRD1 antibody (A2893) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.2s.

Overview

Product name	DRD1 Rabbit pAb
Catalog No.	A2893
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 338-446 of human DRD1 (NP_000785.1).
Sequence	RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT
Gene ID
Swiss Prot
Synonyms	DADR; DRD1A
Calculated MW	49kDa
Observed MW	49kDa

Applications

Reactivity	Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Rat brain
Cellular location	Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein
Customer validation	WB(Mus musculus)