Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Arabidopsis thaliana
Product name | DREB1B Rabbit pAb |
---|---|
Catalog No. | A21961 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of arabidopsis thaliana DREB1B (NP_567721.1). |
---|---|
Sequence | GVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFADSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTNHGLDMEE |
Gene ID | |
Swiss Prot | |
Synonyms | ATCBF1; C-repeat/DRE binding factor 1; DRE BINDING PROTEIN 1B; DREB1B; T30C3.11; TRANSCRIPTIONAL ACTIVATOR CBF1 |
Calculated MW | 24kDa |
Observed MW | 25kDa |
Reactivity | Arabidopsis thaliana |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Seedling, Inflorescences |
Cellular location | nucleus |
* For research use only. Not for therapeutic or diagnostic purposes.