제품 > 항체 > 다중클론항체(pAb)

DRG1 Rabbit pAb (A3987)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using DRG1 Rabbit pAb (A3987) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Overview

Product name	DRG1 Rabbit pAb
Catalog No.	A3987
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including GTPase activity; identical protein binding activity; and potassium ion binding activity. Involved in positive regulation of microtubule polymerization and regulation of mitotic spindle assembly. Located in cytosol and nuclear body. Part of polysome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 158-367 of human DRG1 (NP_004138.1).
Sequence	KKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK
Gene ID
Swiss Prot
Synonyms	NEDD3; DRG1
Calculated MW	41kDa
Observed MW	41kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HepG2, A-549, 22Rv1, HT-29, Mouse liver, Mouse kidney, Rat liver
Cellular location	Cytoplasm
Customer validation	WB(Mus musculus) IP(Mus musculus)